Basic Information | |
---|---|
Taxon OID | 3300000385 Open in IMG/M |
Scaffold ID | PR_CR_10_Liq_1_inCRDRAFT_1024599 Open in IMG/M |
Source Dataset Name | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1466 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cabo Rojo, Puerto Rico | |||||||
Coordinates | Lat. (o) | 17.951083 | Long. (o) | -67.193167 | Alt. (m) | Depth (m) | .05 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061556 | Metagenome | 131 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PR_CR_10_Liq_1_inCRDRAFT_10245993 | F061556 | GGAG | MQNANTYRLATKTKTGDVVQFGPLMSMAIAERKRKAMVALTSYPVY |
⦗Top⦘ |