Scaffold PR_CR_10_Liq_1_inCRDRAFT_1008378

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PR_CR_10_Liq_1_inCRDRAFT_1008378

Scaffold PR_CR_10_Liq_1_inCRDRAFT_1008378

Overview

Basic Information
Taxon OID	3300000385 Open in IMG/M
Scaffold ID	PR_CR_10_Liq_1_inCRDRAFT_1008378 Open in IMG/M
Source Dataset Name	Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	3620
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Cabo Rojo, Puerto Rico
Coordinates	Lat. (^o)	17.951083	Long. (^o)	-67.193167	Alt. (m)		Depth (m)	.05
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061556	Metagenome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
PR_CR_10_Liq_1_inCRDRAFT_10083785	F061556	N/A	MQNLTVYRLATKTNTGDVIQFGPLMSMAIAERKRKAMVALTSYPVYIVNTRAE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.