| Basic Information | |
|---|---|
| Taxon OID | 3300000385 Open in IMG/M |
| Scaffold ID | PR_CR_10_Liq_1_inCRDRAFT_1003725 Open in IMG/M |
| Source Dataset Name | Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6785 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cabo Rojo, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 17.951083 | Long. (o) | -67.193167 | Alt. (m) | Depth (m) | .05 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063630 | Metagenome / Metatranscriptome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PR_CR_10_Liq_1_inCRDRAFT_10037254 | F063630 | GGAG | MTTELVEEYAQKIAPILPQAKKAYGRRSQTSPAHAASREYTRLLKEFYNKGGSLPLLAKKLNVAYAGVRRRVVMSDISVSAFKPKARVKDQDISAAAMRVKQAREKDGDLYHDQLAEEYKSGISLSNLAKELGLSSAAPLYYGVQRSLQRNR* |
| ⦗Top⦘ |