Scaffold DelMOSpr2010DRAFT_101379

Overview

Basic Information

• Taxon OID: 3300000368
• Scaffold ID: DelMOSpr2010DRAFT_101379
• Source Dataset Name: Marine microbial communities from Delaware Coast, sample from Delaware MO Late spring/early summer
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 891
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location

• Location Name: Microbial Observatory off the coast of Delaware, USA
• Coordinates
  • Lat. (^o): 38.84917
  • Long. (^o): -75.1076
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103312	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
DelMOSpr2010DRAFT_1013792	F103312	N/A	VVPVLDLSISEKIEAGKGRSLDGYKCNRLHVNMRMGSEHVGFLGELDLSCFLSLGHHMLVLNSHNTTTPGSSEGNVLVEVGGEVALEVGEVSEVFLSDIGEGNAGSGLGVAELSESCFTSDEAEWDVVLSAESWQENHDLEWVNIVGHDDELGFAFLDESGDVVETEFEVEWLWSGVSGSGTLSGFSFSNESVLLLLSGLWGVLGEELEELGGLVLVDGLLELVEGWW*