NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SL_5KL_010_BRINEDRAFT_10087877

Scaffold SL_5KL_010_BRINEDRAFT_10087877


Overview

Basic Information
Taxon OID3300000350 Open in IMG/M
Scaffold IDSL_5KL_010_BRINEDRAFT_10087877 Open in IMG/M
Source Dataset NameAlkaline brine water microbial communities from Lake Bitter, Kulunda Steppe, Russia - 5KL_010_BRINE
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)801
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location NameRussia: Kulunda Steppe, Lake Bitter
CoordinatesLat. (o)51.4Long. (o)79.54Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079661Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
SL_5KL_010_BRINEDRAFT_100878773F079661N/AMSDTTIQIPESTRDKLKDERLPHESNYGDTIKRLLGDSTGGQLWTEAEIREIISDEIVQN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.