Scaffold SL_5KL_010_BRINEDRAFT_10035924

Overview

Basic Information

• Taxon OID: 3300000350
• Scaffold ID: SL_5KL_010_BRINEDRAFT_10035924
• Source Dataset Name: Alkaline brine water microbial communities from Lake Bitter, Kulunda Steppe, Russia - 5KL_010_BRINE
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1789
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location

• Location Name: Russia: Kulunda Steppe, Lake Bitter
• Coordinates
  • Lat. (^o): 51.4
  • Long. (^o): 79.54

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026202	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_5KL_010_BRINEDRAFT_100359243	F026202	GAG	MKNMVSCNAVLKATMLSMRMGSLELMLRASVFTVLNLNEMGGTTLPREVLRASLSRLVSCGW