Scaffold GreS_7680CDRAFT_1003022

Overview

Basic Information

• Taxon OID: 3300000348
• Scaffold ID: GreS_7680CDRAFT_1003022
• Source Dataset Name: Acidic sulfate chloride spring microbial streamer communities from Grendel Spring, Yellowstone National Park, USA - T=76-80
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2037
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Grendel Spring, Yellowstone National park. Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7230812
  • Long. (^o): -110.7095749

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004156	Metagenome / Metatranscriptome	450	Y

Sequences

Protein ID	Family	RBS	Sequence
GreS_7680CDRAFT_10030225	F004156	GAGG	VRLKLAKEFELTPISRKTISAVLEGIIVALTKLGYLEQDRANELIEKLDSDALNVGQLRLLTDIVVGWFSVCGYFSEAETEHLQELFNHLWGYYDMPLPKSRKRKRKTC*