| Basic Information | |
|---|---|
| Taxon OID | 3300000346 Open in IMG/M |
| Scaffold ID | BeoS_FeMat_6568CDRAFT_1005731 Open in IMG/M |
| Source Dataset Name | Ferric oxide microbial mat communities from Beowulf Spring, Yellowstone National Park, USA - T=65-68 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1636 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Beowulf Spring, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.731451 | Long. (o) | -110.7113131 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006070 | Metagenome / Metatranscriptome | 382 | N |
| F011233 | Metagenome / Metatranscriptome | 293 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BeoS_FeMat_6568CDRAFT_10057313 | F011233 | AGG | LAIPWFLPFVKGWRYHVPQLQTQLLSGIPVSFTGTYTVLNGEFPGYFVSAAIGTTDPNFITRASADGLTVIEVTVGELRDARVYRNQMGEPNILSYGSYIRGFPLPVYALSLSGDGLPFYQSIKIEVVPRNQPALITGFAANIIEIYDVNLFKESTKEFFESIASSPTLPAVPSVPPRLPVRVT* |
| BeoS_FeMat_6568CDRAFT_10057314 | F006070 | AGG | MTLYPYLVVDLPITDTNTHTYRTNPFNPLTPTQPGISLVRLGESVPPIRAFNIYVYNFANATLSVQVIAXENAXNYQYGALLDGLDYQSESXXXRNYQYGALLDGLDYQSESGYPDFNVGSPITVPAGS |
| ⦗Top⦘ |