Scaffold BeoS_FeMat_6568CDRAFT_1004397

Overview

Basic Information

• Taxon OID: 3300000346
• Scaffold ID: BeoS_FeMat_6568CDRAFT_1004397
• Source Dataset Name: Ferric oxide microbial mat communities from Beowulf Spring, Yellowstone National Park, USA - T=65-68
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2148
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (11.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Beowulf Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.731451
  • Long. (^o): -110.7113131

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084460	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
BeoS_FeMat_6568CDRAFT_10043976	F084460	N/A	MSQINPDDLLQKIDEIVNKAIAKYLVKQASKYTPQEINVKFTKNWILVFLPNGYLKISRKFNEGSYKLKILQYKEKK*