NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OneHSP_6670CDRAFT_1014296

Scaffold OneHSP_6670CDRAFT_1014296


Overview

Basic Information
Taxon OID3300000341 Open in IMG/M
Scaffold IDOneHSP_6670CDRAFT_1014296 Open in IMG/M
Source Dataset NameFerrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)644
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOne Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7330426Long. (o)-110.7089928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023140Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
OneHSP_6670CDRAFT_10142962F023140N/ALKLLKRILLSNMFIGLVTVPVYIVLKSFPFFAVFGVGVLTTLTVLILFFFFLGXXFVGXWAVLQKFAVTLPTSXVLTRLVEDVPRNPYLEYVVLFLVGYMISTPLIFLTYHVTRWFYVKKGRLNTPNLRER*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.