Scaffold OneHSP_6670CDRAFT_1002826

Overview

Basic Information

• Taxon OID: 3300000341
• Scaffold ID: OneHSP_6670CDRAFT_1002826
• Source Dataset Name: Ferrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2973
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: One Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7330426
  • Long. (^o): -110.7089928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099549	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
OneHSP_6670CDRAFT_10028265	F099549	N/A	MDTNLQYSYQIPDLKTRFQIDFGNIIEQIVELLTYSDVSTDTRTFDNEELKNKLRAAISYALGLLASTSGYSMSEKIQRDVLTAKNTLIALFDAIMIKPQLTYIDLLDIYFELIQKVSIILNYGTPIPQPRTGNYEIT*