Scaffold EchG_transB_7880CDRAFT_1020498

Overview

Basic Information

• Taxon OID: 3300000340
• Scaffold ID: EchG_transB_7880CDRAFT_1020498
• Source Dataset Name: Ferrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Echinus Geyser, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7220558
  • Long. (^o): -110.7021057

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084460	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
EchG_transB_7880CDRAFT_10204982	F084460	N/A	MSAFNPDDLLQKIDNIVSRAIAKYLAKQAKEYSPEEINIKFTKNWILVFLPNGYLKISKKLSEGQYKLKILQYKEKK*