NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EchG_transB_7880CDRAFT_1006125

Scaffold EchG_transB_7880CDRAFT_1006125


Overview

Basic Information
Taxon OID3300000340 Open in IMG/M
Scaffold IDEchG_transB_7880CDRAFT_1006125 Open in IMG/M
Source Dataset NameFerrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1802
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameEchinus Geyser, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7220558Long. (o)-110.7021057Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011233Metagenome / Metatranscriptome293N

Sequences

Protein IDFamilyRBSSequence
EchG_transB_7880CDRAFT_10061251F011233N/APFVKGWRYHVPELQRQLLSGIPVSFSGNFTVLNGEFPGYFVSAAIGTTDPNFITRASADGLTVIEVTVGDLRDARVYRNQMGEPNILSYGAYIRDFPLPVYALSLNGDGLPFYQSIKIEIIPRNQPAFITGFAANIIEIYDVNLFKESVKEFFESITPTSTPTGVPPRFVANEVVSTRLPVKVT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.