Scaffold actLayA2DRAFT_109210

Overview

Basic Information

• Taxon OID: 3300000339
• Scaffold ID: actLayA2DRAFT_109210
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active layer cDNA A2 Metatranscriptome
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078615	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
actLayA2DRAFT_1092101	F078615	AGG	MISLRLSEAEYEVLXKDYRIYGARNVSDLARLALQRIMTQSVDHQDGYAAKLVDLQHRVLALESRDSTSRGEIGPTADPR