NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold thermBogB3DRAFT_111289

Scaffold thermBogB3DRAFT_111289


Overview

Basic Information
Taxon OID3300000336 Open in IMG/M
Scaffold IDthermBogB3DRAFT_111289 Open in IMG/M
Source Dataset NamePermafrost microbial communities from permafrost in Bonanza Creek, Alaska - Thermokarst Bog cDNA B3 Metatranscriptome
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)580
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032176Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
thermBogB3DRAFT_1112892F032176N/AGDMGVLKGYSLMKMVPGKNPTSVGLWXFMTMSEKLGWLNDTITLVTFEAADPMWMDLNVTIWEWK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.