NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SI39nov09_100mDRAFT_1010840

Scaffold SI39nov09_100mDRAFT_1010840


Overview

Basic Information
Taxon OID3300000325 Open in IMG/M
Scaffold IDSI39nov09_100mDRAFT_1010840 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2384
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet 39, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.35Long. (o)-123.29Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023827Metagenome208Y

Sequences

Protein IDFamilyRBSSequence
SI39nov09_100mDRAFT_10108401F023827N/ALENWKRFLNENQELSFLPDEVLRGEEEFDEYEGEEGVLVKNIPMKALSMLASQGKAVLTDIWRSELSMTEGLPVLFYHTDEQQLIVDDGNHRIFQKWLKGENTFDAYVYSGSWHGTLRHVYDGEEKFDWDEEYRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.