NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold WSSedL2TaDRAFT_1022239

Scaffold WSSedL2TaDRAFT_1022239


Overview

Basic Information
Taxon OID3300000317 Open in IMG/M
Scaffold IDWSSedL2TaDRAFT_1022239 Open in IMG/M
Source Dataset NameWetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L2 Tule
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)665
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location
Location NameTwitchell Island in the Sacramento/San Joaquin Delta, CA
CoordinatesLat. (o)38.106796Long. (o)-121.646457Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034230Metagenome / Metatranscriptome175Y

Sequences

Protein IDFamilyRBSSequence
WSSedL2TaDRAFT_10222392F034230N/AEAGPENDKLKVKVGPFFIQESEKKINLEGTASHVVRKGKRINVTVTVENYGKEKSEPVRLKYVETGKKAGEPRFYRIQAIEPGKKWERTFMARFDESGRKSVTATLLTLENQPLADEKGKSRPDTSHTGSVNLTVKEM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.