Basic Information | |
---|---|
Taxon OID | 3300000317 Open in IMG/M |
Scaffold ID | WSSedL2TaDRAFT_1000081 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L2 Tule |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8229 |
Total Scaffold Genes | 13 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (76.92%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula boonei | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Twitchell Island in the Sacramento/San Joaquin Delta, CA | |||||||
Coordinates | Lat. (o) | 38.106796 | Long. (o) | -121.646457 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067458 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
WSSedL2TaDRAFT_10000812 | F067458 | AGGTGG | MKRLVFAGLIFLVLLQGIWFAAADDSPDYAKIVVVHLTINKSSITEKSVEMRYGHPPNIEARNGDFKGTLKTADGSTIREFNLWDPRYQLGDVLEKNNESSGYLSGYLTYSDNADLVLILPYYENQMTFELYDKKTGTLLKKVNMSQAITKFQSNYPKDPGSISVSPIQFDKSVLYVITGVVISILIIGMILSMVRKK* |
⦗Top⦘ |