Scaffold WSSedB1CaDRAFT_10016211

Overview

Basic Information

• Taxon OID: 3300000313
• Scaffold ID: WSSedB1CaDRAFT_10016211
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1646
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location

• Location Name: Twitchell Island in the Sacramento/San Joaquin Delta, CA
• Coordinates
  • Lat. (^o): 38.10726
  • Long. (^o): -121.648538
  • Depth (m): 1.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041289	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
WSSedB1CaDRAFT_100162113	F041289	AGAAGG	MSEDLLDHWVKLLKPFFPANAWIVTRYSKDDHIIEIDWNLDNEPGQPKRRSRKIQITISDGAIEDYLDKDKKERETFESSLTKLIQERYNLVSPDSQMQTSTSSSADRLLIKKDTLNA*