Basic Information | |
---|---|
Taxon OID | 3300000310 Open in IMG/M |
Scaffold ID | WSSedA1Ba2DRAFT_1011427 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1108 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Twitchell Island in the Sacramento/San Joaquin Delta, CA | |||||||
Coordinates | Lat. (o) | 38.107057 | Long. (o) | -121.647578 | Alt. (m) | Depth (m) | 0 to .12 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067886 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
WSSedA1Ba2DRAFT_10114273 | F067886 | N/A | FIRENCPRAGEQLLEINERMRYFDPESYSQALGAVQKILVIVADTLVPHGEKIYRDKKGHERSIAPDQYLNRIFSYIEQNSGNDPGVSLIESEMAYIFAKAEHPHEKTRVSHERVSKDDVELAIIHMYLVIAEIAKIRKIETIYLKTSPSGNFDTVSKLSPPGLE* |
⦗Top⦘ |