| Basic Information | |
|---|---|
| Taxon OID | 3300000309 Open in IMG/M |
| Scaffold ID | WSSedA1BaDRAFT_1065249 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 584 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Twitchell Island in the Sacramento/San Joaquin Delta, CA | |||||||
| Coordinates | Lat. (o) | 38.107057 | Long. (o) | -121.647578 | Alt. (m) | Depth (m) | 0 to .12 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092121 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| WSSedA1BaDRAFT_10652491 | F092121 | GAGG | MPKHFYTLLIIPHKKKDSVKKFLATPIHFRVVTAVSVVLFCFFGYCAVDYLTIKLEQMELANLRQLTSTQQEQIDTLQEKISFFDRKLADLKQVDEKIRNMASDLTGKSRKPSRKEEAKSREQVLGI |
| ⦗Top⦘ |