| Basic Information | |
|---|---|
| Taxon OID | 3300000305 Open in IMG/M |
| Scaffold ID | bgg_mtDRAFT_1036889 Open in IMG/M |
| Source Dataset Name | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 539 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Blue Grama Grass Rhizosphere Eukaryotic And Microbial Communities From Sevilleta Long Term Ecological Research Site, New Mexico, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sevilleta Long Term Ecological Research site, New Mexico, US | |||||||
| Coordinates | Lat. (o) | 34.3348 | Long. (o) | -106.631 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076953 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| bgg_mtDRAFT_10368892 | F076953 | AGGAGG | VEEYEEETPQEEVEKAKAVRAESFPGGVPEDADVETGRQKGVGLPPGSVGKGQDTPQTPAT* |
| ⦗Top⦘ |