| Basic Information | |
|---|---|
| Taxon OID | 3300000285 Open in IMG/M |
| Scaffold ID | EM251_1000038 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Cork, Ireland - EM251 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 89890 |
| Total Scaffold Genes | 102 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 89 (87.25%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → unclassified Herelleviridae → Herelleviridae sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cork, Ireland | |||||||
| Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042737 | Metagenome / Metatranscriptome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| EM251_100003847 | F042737 | AGGAG | MKLTEKSQIVFEYLKNNGGKVSIEELANATGRSARSVGANVLDLTKKGLVVREKEEVEGAEKPVAYAILTDAGKTFVPSDDAE* |
| ⦗Top⦘ |