Scaffold EM219_1026851

Overview

Basic Information

• Taxon OID: 3300000279
• Scaffold ID: EM219_1026851
• Source Dataset Name: Human fecal microbial communities from Cork, Ireland - EM219
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI), Macrogen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6040
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location

• Location Name: Cork, Ireland
• Coordinates
  • Lat. (^o): 51.907
  • Long. (^o): -8.472

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059106	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
EM219_10268512	F059106	AGG	MHAIVWKIRVILLQTFVWIVDLKVREHLTEYLKKDIKYHRVIIGVFV*