| Basic Information | |
|---|---|
| Taxon OID | 3300000270 Open in IMG/M |
| Scaffold ID | HuiMet_106990 Open in IMG/M |
| Source Dataset Name | Marine microbial mat from the Comau fjord, Huinay, Chile. Sample sequenced in March 2012 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | OMICS Solution |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1105 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Marine → Marine Microbial Communities From The Comau Fjord, Huinay, Region De Los Lagos, Chile |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chile: Los Lagos Region | |||||||
| Coordinates | Lat. (o) | -42.021639 | Long. (o) | -72.689161 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001728 | Metagenome / Metatranscriptome | 645 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| HuiMet_1069902 | F001728 | N/A | MNSVELIEVSKDYYRLMLNGVDVTGVQERSVFRHLLEVVDNKISN* |
| ⦗Top⦘ |