| Basic Information | |
|---|---|
| Taxon OID | 3300000268 Open in IMG/M |
| Scaffold ID | M3P_10206145 Open in IMG/M |
| Source Dataset Name | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 576 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Solway, Minnesota | |||||||
| Coordinates | Lat. (o) | 47.349634 | Long. (o) | -95.182806 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060906 | Metagenome | 132 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| M3P_102061451 | F060906 | N/A | MAKLIFIINEEENREASKIEFEVPNDMDVWEYKRMCIRMAGAMGYTSL |
| ⦗Top⦘ |