| Basic Information | |
|---|---|
| Taxon OID | 3300000265 Open in IMG/M |
| Scaffold ID | LP_A_09_P04_10DRAFT_1006053 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2947 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Line P, Station P4 | |||||||
| Coordinates | Lat. (o) | 48.65 | Long. (o) | -126.666667 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012286 | Metagenome / Metatranscriptome | 282 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LP_A_09_P04_10DRAFT_10060534 | F012286 | N/A | MLRNPNSIPSTDTLIQDPAMEPFFITRSQTGGFTVYERVVKGENNTEYIKTISYPSNFGNALKTVTTEIVNEGGKTYNLKNYVERWESVKNSLLSIVD* |
| ⦗Top⦘ |