Scaffold LP_A_09_P04_10DRAFT_1002737

Overview

Basic Information

• Taxon OID: 3300000265
• Scaffold ID: LP_A_09_P04_10DRAFT_1002737
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5020
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, Station P4
• Coordinates
  • Lat. (^o): 48.65
  • Long. (^o): -126.666667
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093696	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
LP_A_09_P04_10DRAFT_10027372	F093696	AGGA	MGHPVNVFWELLKNLKDLVVSVKIGSSEAVPHGAVLEQLSNTTFKVEDGEGNQGVCELVNKHTEQLLDNEMSILGFVLNSSAFVYIASIVNNIMNDFTNKEYTWHLDNDSTTNVLILTGKL*