Scaffold LP_A_09_P04_1300DRAFT_1050090

Overview

Basic Information

• Taxon OID: 3300000262
• Scaffold ID: LP_A_09_P04_1300DRAFT_1050090
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_1300
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 541
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, Station P4
• Coordinates
  • Lat. (^o): 48.65
  • Long. (^o): -126.666667
  • Depth (m): 1300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083802	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
LP_A_09_P04_1300DRAFT_10500902	F083802	N/A	LKHKESRFNTLFPKRLEKVYSTIRSLSKLSNRNNYFYDSSNIFMALSSIVFELRELAASYGLDSSDIKIDIYSLSDQQKKPTLKTDDIRNNDAKDIASELLEIIEKKIKTEEKLHSEINTLKRELSFLRDKVENQQWSSTRNFT*