Scaffold LP_J_09_P20_1000DRAFT_1042020

Overview

Basic Information

• Taxon OID: 3300000258
• Scaffold ID: LP_J_09_P20_1000DRAFT_1042020
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_09_P20_1000
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus → Algoriphagus machipongonensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, North Pacific Ocean
• Coordinates
  • Lat. (^o): 48.35
  • Long. (^o): -123.3
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083802	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
LP_J_09_P20_1000DRAFT_10420201	F083802	N/A	KTDVQTEKIGYSKWLKHKESRFNALFPKRLEKVYSTIRSLSKLSNRNNYFYDPSNIFMALSSIVLELRELAASYGLDSSDIKIDIYSLSDQQKKXTLXTDDIRNNDAKDIASELLEIIEKKIKTEEKLHSEINTLKRELSFLRDKVENQQWSSTRNFT*