Scaffold LP_F_10_SI03_120DRAFT_1004975

Overview

Basic Information

• Taxon OID: 3300000256
• Scaffold ID: LP_F_10_SI03_120DRAFT_1004975
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4448
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, North Pacific Ocean
• Coordinates
  • Lat. (^o): 48.35
  • Long. (^o): -123.3
  • Depth (m): 120

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015345	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
LP_F_10_SI03_120DRAFT_10049756	F015345	N/A	LTTVDLFAIKERIVDILKSDTTNLWDSTPSDKTKFRKIEAGSPSPKAIQEPPLPRLWVTSDDVVANVSHISVVKDNVHLGDEYDIRIKILFVVEAKDGSKTEESIDDFTKSIIEKLEANYDLRAVGGAVATRLAESSQVTQIMDLPSMFKGDRVKGRVIKFKVIVRV*