Scaffold SI34jun09_100mDRAFT_1008017

Overview

Basic Information

• Taxon OID: 3300000254
• Scaffold ID: SI34jun09_100mDRAFT_1008017
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3057
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet 34, Vancouver Island, BC, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068146	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
SI34jun09_100mDRAFT_10080172	F068146	N/A	MKIDNSSYTVTPPDLYMTEHGISILISSTNTDFIVSVKELFEKFIATSIVFLVQNKKTNSETLPWMWNVSKTCDFMIVDVDTCAWEDIMAGLLKSKDEENTVLFYSDKYKRRETVKLINATGTNLVVRSLDDINNYIKLQMSPEYFNES*