Scaffold LPaug09P26500mDRAFT_1017622

Overview

Basic Information

• Taxon OID: 3300000247
• Scaffold ID: LPaug09P26500mDRAFT_1017622
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P26 500m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1049
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P26, Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0
  • Long. (^o): -145.0
  • Depth (m): 500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001235	Metagenome / Metatranscriptome	741	Y

Sequences

Protein ID	Family	RBS	Sequence
LPaug09P26500mDRAFT_10176223	F001235	AGG	MATKLNVDTGGFGIGKKLWEKHQADEFTHVDNYKEAICINCFTKDASSATIADICGECAGKRGREPLLATISQKLYGLCYFCGQYKFQIEQINARFCRSCHRKIANVTKEYNKKGGMLGADPFWLSMKKKHGKDWRHSFNDPTTSIRR*