Basic Information | |
---|---|
Taxon OID | 3300000242 Open in IMG/M |
Scaffold ID | TDF_OR_ARG05_123mDRAFT_1038803 Open in IMG/M |
Source Dataset Name | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1002 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ushuaia Bay, Tierra del Fuego, Argentina | |||||||
Coordinates | Lat. (o) | -54.810872 | Long. (o) | -68.295525 | Alt. (m) | Depth (m) | 12.3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072360 | Metagenome / Metatranscriptome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TDF_OR_ARG05_123mDRAFT_10388032 | F072360 | N/A | MNRKLNILSVFSRRAICIAFTLLIALSFSAGGVLANSCQGGVDCLICAAAVHPHIPGMDVEMVNQGCQSAEQNSSCGFETGRSADELDRTAAVIKSGTHPYPGIFSAASDESDRAHLYREFITQFQNPDRSELTPIYLLNLSLLC* |
⦗Top⦘ |