| Basic Information | |
|---|---|
| Taxon OID | 3300000242 Open in IMG/M |
| Scaffold ID | TDF_OR_ARG05_123mDRAFT_1003673 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4346 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ushuaia Bay, Tierra del Fuego, Argentina | |||||||
| Coordinates | Lat. (o) | -54.810872 | Long. (o) | -68.295525 | Alt. (m) | Depth (m) | 12.3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039145 | Metagenome / Metatranscriptome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TDF_OR_ARG05_123mDRAFT_10036733 | F039145 | N/A | MKNFLISLLVSLALLSGCSEEGVKTPVEMSAFIEELKANGVEGSLLIRAPFNEDMEYVAEYAIAKYASTRIISVFKFKDAEKAEANLQEALKNDKLSGQASNGTFVMAATFYPPNEEAVEKIKALFLAHEFE* |
| ⦗Top⦘ |