Scaffold TDF_OR_ARG05_123mDRAFT_1001881

Overview

Basic Information

• Taxon OID: 3300000242
• Scaffold ID: TDF_OR_ARG05_123mDRAFT_1001881
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 6193
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: Ushuaia Bay, Tierra del Fuego, Argentina
• Coordinates
  • Lat. (^o): -54.810872
  • Long. (^o): -68.295525
  • Depth (m): 12.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011565	Metagenome	289	Y

Sequences

Protein ID	Family	RBS	Sequence
TDF_OR_ARG05_123mDRAFT_10018812	F011565	N/A	MANVNPPSGKSVANTLYHGAVVGGLSVGYSMLSKRLLKIKPADLGRLDIEDAVKVTTTVAAAIATRDMLVQQGIIPADILK*