| Basic Information | |
|---|---|
| Taxon OID | 3300000241 Open in IMG/M |
| Scaffold ID | BS_KBA_SWE21_205mDRAFT_10055447 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 915 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | KBB site, Vaertahamnen, Baltic Sea, Sweden | |||||||
| Coordinates | Lat. (o) | 59.350163 | Long. (o) | 18.107847 | Alt. (m) | Depth (m) | 20.5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019578 | Metagenome | 229 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BS_KBA_SWE21_205mDRAFT_100554471 | F019578 | N/A | MGKHAIGPWHVRKKGEAVGVIGDDSSVVAVFPRKNNSDDTRINEAYLLAAAPLMLEVCSKIHSILENSLVVTPEGFKMNISDIQESLVDA |
| ⦗Top⦘ |