Basic Information | |
---|---|
Taxon OID | 3300000241 Open in IMG/M |
Scaffold ID | BS_KBA_SWE21_205mDRAFT_10002136 Open in IMG/M |
Source Dataset Name | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6549 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | KBB site, Vaertahamnen, Baltic Sea, Sweden | |||||||
Coordinates | Lat. (o) | 59.350163 | Long. (o) | 18.107847 | Alt. (m) | Depth (m) | 20.5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056545 | Metagenome / Metatranscriptome | 137 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BS_KBA_SWE21_205mDRAFT_100021362 | F056545 | N/A | MTRFIYLLLAILAVAPRYGLSQCTDSSTLAASNYYLIKGAEARENLALCREYRKIDSAVIETQGRMQDKLLNEIKMRDDKYIRLRRVTYVIAAAFILTLIL* |
⦗Top⦘ |