Scaffold SI36aug09_120mDRAFT_1030783

Overview

Basic Information

• Taxon OID: 3300000239
• Scaffold ID: SI36aug09_120mDRAFT_1030783
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1184
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet 36, Vancouver Island, BC, Canada
• Coordinates
  • Lat. (^o): 48.5663346
  • Long. (^o): -123.5193257
  • Depth (m): 120

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078736	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
SI36aug09_120mDRAFT_10307831	F078736	GGAGG	MTDELKEWYLMPSITECLVEYEKQDIGLIADIAKHGCSGGVAGIV