Scaffold SI36aug09_100mDRAFT_1044136

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SI36aug09_100mDRAFT_1044136

Scaffold SI36aug09_100mDRAFT_1044136

Overview

Basic Information
Taxon OID	3300000238 Open in IMG/M
Scaffold ID	SI36aug09_100mDRAFT_1044136 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 100m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	510
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Saanich Inlet 36, Vancouver Island, BC, Canada
Coordinates	Lat. (^o)	48.5663346	Long. (^o)	-123.5193257	Alt. (m)		Depth (m)	100
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078538	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
SI36aug09_100mDRAFT_10441363	F078538	N/A	SIDNDDYIDKMERMHKCDVNQTEPEWPFFDGNNYFDPNEEENI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.