Basic Information | |
---|---|
Taxon OID | 3300000238 Open in IMG/M |
Scaffold ID | SI36aug09_100mDRAFT_1025129 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 100m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 748 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Saanich Inlet 36, Vancouver Island, BC, Canada | |||||||
Coordinates | Lat. (o) | 48.5663346 | Long. (o) | -123.5193257 | Alt. (m) | Depth (m) | 100 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033603 | Metagenome | 177 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SI36aug09_100mDRAFT_10251292 | F033603 | N/A | FRLAYEFIISSMEEDEEYENLEFVNKDLPHKTLDKLITFFEKTEEYEKCSKLQKIKHARLFEYSKYNL* |
⦗Top⦘ |