| Basic Information | |
|---|---|
| Taxon OID | 3300000231 Open in IMG/M |
| Scaffold ID | TB_LI09_4DRAFT_10077775 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1281 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lago Infinito, wall in 6.8 m depth, Frasassi Caves, Italy | |||||||
| Coordinates | Lat. (o) | 43.383333 | Long. (o) | 12.95 | Alt. (m) | Depth (m) | 6.8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056321 | Metagenome / Metatranscriptome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TB_LI09_4DRAFT_100777752 | F056321 | GGAG | MPHMEAPALPPVIYVHVEFYRGVKAIAKFLGVHERTAQAFLHDGKIPGKKDGTGTWVLTNLDYFTSLQR* |
| ⦗Top⦘ |