| Basic Information | |
|---|---|
| Taxon OID | 3300000230 Open in IMG/M |
| Scaffold ID | TB_GS10_10DRAFT_10044130 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2083 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Grotta Sulfurea, Talus Pool, Frasassi Caves, Italy | |||||||
| Coordinates | Lat. (o) | 43.383333 | Long. (o) | 12.95 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050966 | Metagenome / Metatranscriptome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TB_GS10_10DRAFT_100441301 | F050966 | GAGG | MSGSMWQGMKTRHGVGTEALSEEMESNGSATPKSWRHPLTLPPDVWDSARFRSIFLASGFSCSQ |
| ⦗Top⦘ |