| Basic Information | |
|---|---|
| Taxon OID | 3300000229 Open in IMG/M |
| Scaffold ID | TB_LI09_3DRAFT_1006888 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3078 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lago Infinito, wall in 7.1 m depth, Frasassi Caves, Italy | |||||||
| Coordinates | Lat. (o) | 43.383333 | Long. (o) | 12.95 | Alt. (m) | Depth (m) | 7.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085384 | Metagenome / Metatranscriptome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TB_LI09_3DRAFT_10068886 | F085384 | AGGA | MSYTIENITTKEVTTKFGPKPAYSIIANGERFSYGFKKPMFAIGDEVDFQYTENTYGKTVDLTSVQMIKKGSGSAPTTTAPSAAKAPYSPPAKVFPIPPLHGDRAIVRQNSITNATKAVNDMLTGGEAEAYSGTFEEYAADIIHVARMFEAYSCGDLDAQAAEAMVVG* |
| ⦗Top⦘ |