NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPjun09P410mDRAFT_1012887

Scaffold LPjun09P410mDRAFT_1012887


Overview

Basic Information
Taxon OID3300000223 Open in IMG/M
Scaffold IDLPjun09P410mDRAFT_1012887 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P4 10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)717
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP4, Pacific Ocean
CoordinatesLat. (o)48.65Long. (o)-126.666667Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005578Metagenome / Metatranscriptome396Y
F007226Metagenome / Metatranscriptome355Y

Sequences

Protein IDFamilyRBSSequence
LPjun09P410mDRAFT_10128872F007226AGGGGGMQKLLNKITFYFLNRAFTQMEQSNDLQNDDKVAEHIEDYYTYFVK*
LPjun09P410mDRAFT_10128873F005578GAGGMQKNITTRELKHLCNFLTHEMNYKVELVTDEDFACDEDGGENVYDWVAATEELCGRTQCVLDNYFTHKDSTLATAFETAIDYRYDDDCINEGISEHFFDYCKKHNILEFYFKQADAHD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.