Scaffold LPjun09P12500mDRAFT_1056145

Overview

Basic Information

• Taxon OID: 3300000222
• Scaffold ID: LPjun09P12500mDRAFT_1056145
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 634
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P12, Pacific Ocean
• Coordinates
  • Lat. (^o): 48.97
  • Long. (^o): -130.666667
  • Depth (m): 500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077773	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
LPjun09P12500mDRAFT_10561452	F077773	N/A	MFASFFLQKSPENYENETNITKFKSKRKMFIKQQLGLELYGPIAPKLQRTPTRG*