Scaffold LPjun09P12500mDRAFT_1046173

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LPjun09P12500mDRAFT_1046173

Scaffold LPjun09P12500mDRAFT_1046173

Overview

Basic Information
Taxon OID	3300000222 Open in IMG/M
Scaffold ID	LPjun09P12500mDRAFT_1046173 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	729
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	P12, Pacific Ocean
Coordinates	Lat. (^o)	48.97	Long. (^o)	-130.666667	Alt. (m)		Depth (m)	500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050431	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
LPjun09P12500mDRAFT_10461734	F050431	AGGA	MRYFVGAWVLCCIGYVGGDILTSSLGVGAAFGFIDF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.