NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPfeb10P161000mDRAFT_c1017161

Scaffold LPfeb10P161000mDRAFT_c1017161


Overview

Basic Information
Taxon OID3300000219 Open in IMG/M
Scaffold IDLPfeb10P161000mDRAFT_c1017161 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 1000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1427
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP16, Pacific Ocean
CoordinatesLat. (o)49.283333Long. (o)-134.666667Alt. (m)Depth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013022Metagenome / Metatranscriptome275N

Sequences

Protein IDFamilyRBSSequence
LPfeb10P161000mDRAFT_10171614F013022N/AMSDIRLVKLKSGEEIIGDVTVIGQDVIISSPCQLMSTEHGIGFVPWPPFAKHDNVTVKMDWVICITQPVNAARDAWNQKFGSGIILPNVQLNE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.