Scaffold LowMDraftT1_c147737

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LowMDraftT1_c147737

Scaffold LowMDraftT1_c147737

Overview

Basic Information
Taxon OID	3300000210 Open in IMG/M
Scaffold ID	LowMDraftT1_c147737 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from New Zealand - Low methane emitting sheep
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	624
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep

Source Dataset Sampling Location
Location Name	Hamilton, New Zealand
Coordinates	Lat. (^o)	-45.483333	Long. (^o)	170.716667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008062	Metagenome / Metatranscriptome	340	Y

Sequences

Protein ID	Family	RBS	Sequence
LowMDraftT1_1477371	F008062	N/A	DGVVHLFKGLAETEEAKCAAVLTNNKAQILEIINAAIAEVKAGTPIETAVQNAALKLMGIDGLVSECNVLAMPAIITKFTTKEGLVEIFQTLIDNIDEVYSYGEKIKEGIQNKDYNAAAEALGHILAIALDFHVNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.