Scaffold M3P_c10034819

Overview

Basic Information

• Taxon OID: 3300000206
• Scaffold ID: M3P_c10034819
• Source Dataset Name: Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 755
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota

Source Dataset Sampling Location

• Location Name: USA: Solway, Minnesota
• Coordinates
  • Lat. (^o): 47.349634
  • Long. (^o): -95.182806
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041757	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
M3P_100348191	F041757	N/A	MQNPVNFRKSAVHSDGEGGIIIETRQDITDILEQNKKEYNSYDERAKWSDNLFGNKVASI